Spray Ban May Be Coming

MANITOBA could soon join nearly every other province and ban cosmetic pesticides, the chemicals in sprays like WeedEx and RoundUp that keep lawns perfect by zapping weeds and bugs.

"I'm certainly open to it," said Conservation Minister Bill Blaikie. "The government is considering what steps might be taken in terms of public consultation." The move comes after Blaikie asked the province's round table for sustainable development to study the issue of cosmetic pesticides. Last month, the round table came back with a call for a province-wide ban.

It's about time, say local and national environmental groups, including the David Suzuki Foundation.

According to a 2009 Statistics Canada survey, 47 per cent of Manitobans report using chemical pesticides to perfect their lawns and gardens. That's the second-highest rate in the country. Meanwhile, Manitoba is out of step with most other provinces in its failure to enact a province-wide ban on herbicides and insecticides used for cosmetic purposes.

This week, the David Suzuki Foundation released a report evaluating provincial pesticide bans and found Ontario and Nova Scotia's were the toughest.

Manitoba didn't even earn a passing mention in the report because the province has no legislation to review.

Manitoba is one of only four Canadian provinces with no pesticide ban and that club is about to shrink. British Columbia just finished a long round of public consultations on a possible ban and new Liberal Premier Christy Clark has said she supports one.

"It's just low-hanging fruit," said Lisa Gue, an environmental health policy analyst at the David Suzuki Foundation. "It's a completely needless exposure we can just do without." Unlike dozens of municipalities in Canada, no Manitoba city has an all-out cosmetic pesticide ban.

"Currently, what we have is kind of behind the times," said Kristine Hunter, a University of Manitoba instructor in the department of environment and geography. "When you look at the evidence on pesticides, there is really strong evidence now about serious human harm. We're talking cancer and links to ALS." But Hunter, who sits on the province's sustainability round table, says she senses a shift in political will.

"I'm the most hopeful I've been in 10 years of advocating for this," she said.

Local commercial lawn maintenance companies have traditionally resisted a pesticide ban, in part because it could damage their industry.

Dana Kapusta, co-owner of Nutri-Lawn in Winnipeg, proposes a compromise. He suggested the province ban the retail sale of chemical pesticides but continue to allow lawn-care companies to use them. Kapusta said professionals are trained to apply the pesticides sparingly and safely and ought to be allowed to continue to have access to at least some of the products.

And he said Manitobans might not be ready for the kind of weed and dandelion invasion that left some in Ontario grumbling the summer after that province banned cosmetic pesticides.

"A beautiful city will go to hell in a handbasket pretty quickly if the weeds aren't under control," said Kapusta.

Kapusta said his customers have already begun moving toward non-chemical pesticide alternatives.

Organic lawn care products are more expensive and take longer to apply, but he's seen a sixfold increase in the number of customers asking for Nutri-Lawn's organic product this summer over last.

Cities can ban the use of pesticides but only the province can ban the sale - a much more effective method of reducing pesticide use.

A province-wide ban also makes enforcement much easier because inspectors only have to check a few home and garden stores, not every homeowner. And, it ensures the ban covers the entire province, not just a handful of cities.

A ban won't be in place in time for this gardening season, and Blaikie wouldn't guess when public consultations might begin. They could start before this October's provincial election.

Gue said there's no reason to delay.

"It's no longer a matter of reinventing the wheel," said Gue. "There are strong models that have been test driven in other province and the sky hasn't fallen. There are still lush and beautiful green spaces in all those provinces." BAN CHRONO April 2003: Quebec introduces Canada's first province-wide pesticide ban that targeted 20 active ingredients. The use and sale of pesticides was phased out three years later. In 2009, a Statistics Canada survey found that only four per cent of Quebeckers reported using cosmetic pesticides.

March 2006: Brandon enacts a bylaw restricting cosmetic pesticide use near schools, daycares, parks and many other public spaces and requiring lawn-care companies to post warning signs when they apply chemicals.

May 2008: Winnipeg enacts some restrictions on pesticides, requiring lawn-care companies to post warning signs when they apply chemicals and allowing residents to request no-spray buffer zones.

June 2008: Ontario adopts what's widely seen as Canada's toughest and most comprehensive pesticide ban. It prohibits the use and sale of 96 active ingredients as well as the sale of 172 products.

Dec. 31, 2012: A federal ban on weed-and-feed kicks in. That's the combination product that fertilizes lawns while also killing weeds, and it's widely seen as overused, ineffective and environmentally damaging.

MAKE YOUR OWN BAN - Avoid any of these big baddies: 2,4-D mecoprop, dicamba, glyphosate, diazinon and carbaryl. Also avoid weed-and-feed. Even Alberta has banned that.

- Tolerate a few weeds and dandelions, or pick them by hand.

- To make your own insecticide, try mixing a tablespoon of liquid dishwashing soap with a cup of vegetable oil to make a concentrate. Mix a couple of teaspoons of the concentrate with a cup of water in a spray bottle and apply to stems and both sides of plant leaves. Reapply after it rains.

- Or, try the garlic remedy. Many bugs hate the smell. Soak half a cup of finely chopped garlic cloves in two cups water for about a day, then strain out the garlic into a spray bottle. Spray a fine mist over plants. To increase the potency of the insecticide, add crushed hot peppers or a tablespoon of dissolved pure soap to make the spray stick to the insect.

- Try diatomaceous earth, a powdery white substance that you can buy at most garden stores. It's an abrasive that cuts the bodies of insects, but it's non-toxic.

- To kill weeds, try vinegar. Boil a quart of water, add two tablespoons of salt and five tablespoons of vinegar. Pour directly on weeds on sidewalks and driveways while the mixture is still hot.

- Source: Manitoba Eco Network WHAT A BAN COULD LOOK LIKE - Wouldn't apply to farms or forestry, only lawns and other public green space.

- Would likely list dozens of banned chemicals that can't be used or sold, along with a "white list" of products that are alright.

- Probably wouldn't apply to golf courses, unless Manitoba was considering a much tougher ban than exists elsewhere. Golf courses are the next frontier of pesticide bans. Denmark is already on the case.

- Wouldn't apply to pesticides used for health issues such as mosquitoes carrying the West Nile virus. Also would likely exempt indoor use of bug-killing sprays for things such as ant infestations or wasps who fly into a home.

- Would probably exempt some herbicides used for dangerous plants such as poison ivy. In Ontario, homeowners can still buy some heavy-duty herbicides if they have a problem such as poison ivy, but the herbicides are kept under lock-and-key at home and garden stores.

HOT PRODUCTS
no data
GET IN TOUCH WITH US
you might like
no data
recommended articles
Blog
Table Runners for Round Tables: Find the Right Table Runner
Do I have to use a runner with a tablecloth? Naturally, you do not have to use a tablecloth with a table runner. If you like the idea of a tablecloth but happen to use the kitchen table in other ways (like for kids doing their homework), then a runner offers a touch of practical beauty. On the other hand, you might have a gorgeous antique dining table or farmhouse table you love to show off. Laying a beautiful table linen down the middle of the table dresses it up just enough for special celebrations.Can I put table salt in a foot soak?Epsom Salt Substitutei asked about my kieens jumping on the table .?The only thing i can suggest is when they jump on the table discipline them in some way so they know they are being bad and then when they behave stroke them or in some way let them know they are being good if that does not work shut them out of the kitchen when you eat! Hope this helps!What family friendly dishes do you put on your Thanksgiving table?Well I do not have kids but I used to help my mom prepare green bean casserole, homemade mac and cheese, roasted or mashed potatoes, pecan pie, just to name a few ;)Number of primary key constraints can be created for a table in sql server?only one primary key can be created in one tableWhy does simple ALTER TABLE command take so long on table with full-text index?Full-text-indexing is, likely, irrelevant to your problem. Previous to SQL Server 2012 the ADD COLUMN NOT NULL DEFAULT ... is an offline operation that has to run an update and populate each row with the new default value of the newly added column. In SQL Server 2012, the operation is much faster, see Online non-NULL with values column add in SQL Server 11 as it only updates the metadata of the table and does not actually update any rows.Your ALTER TABLE is most likely slow because of the update. Remember, since that is a single transaction, a huge log will be generated and your log is likely growing now and being constantly zero-ed out as it expands. However, it might also be slow because of ordinary contention: the statement may not be able to acquire the SCH-M lock on the table. Looking at sys.dm_exec_requests should show if this is the case, the wait_type and wait_resource columns would indicate if the ALTER statement is blocked or is making progressSetting Up Python Script tool ESRI arcpy to download files from tableAs you have a map layer in your map document, you need to work not on the .lyr file, but instead on the Layer object. To get the Layer object in your current map document, use the arcpy. ListLayers() function. When you select certain features on the map, you run the cursor for the map layer object:The cursors respect the selection; so you get back only the rows that were selectedPostgres join where foreign table has ALL recordsA small variant on mendosi's answer, which avoids WITH:This approach has some small differences with regard to his/her approach:dbfiddle hereIf you are looking for the fastest possible solution, I would check different approaches under practical conditions, and decide based on the timings you actually get. My proposed query is very standard, and should not be slower than the one with a WITH, but whether it is slower or faster than other approaches, I do not really know in advancecan i fit a pool table in my garage?I think 8 by 4 feet table could fit in your garage. You can go for a 8 ft tableHow can i remove bubble wrap markings from a wood vaneer table.I tried furniture polish and dosen't work.?You might try rubbing with 0000 steel woolIn study hall, I accidentally sat at the wrong table and...?Hehe, that's so typical that always happens to me. I mean were they assigned seats or anyone's seats if they were assigned say "gosh it was just an accident no need to panic ok do you need an inhaler or something?" if they were not assigned seats say " if im sitting here and you do not want me here go sit somewhere else with people your type"(with sarcastic voice)
In How Many Ways Can 6 Men and 6 Women Sit at a Round Table so that No Two Men Are Together?
I am assuming this problem posits each man and woman seated in his or her own seat. Also that the men and women are sitting in alternate seats so that neither men nor women are sitting next to a person of the same sex.this being the case it sets up the same problem where six men sit at one table and six women at a second table. In each case the men and women each can be seated in 6 factorial ways, 6x5x4x3x2x1, which is 720 ways for the men and 720 ways for the women. This totals 1440 possible combinations1. cute, silly, funny or love quotes?Cute and Lovey: Friendship is like peeing your pants. Everyone can see it, but only you can truly feel its warmth. You learn to like someone when you find out what makes them laugh, but you can never truly love someone until you find out what makes them cry Life is not about how many breathes you take, It's about how many moments that take your breath away A stranger stabs you in the front; a friend stabs you in the back; a boyfriend stabs you in the heart, but best friends only poke each other with straws. The person who is worth crying over will never make you cry. Funny: When there's a will, I want to be in it A computer once beat me at chess, but it was no match for me at kick boxing. Whoever said nothing is impossible, never tried to slam a revolving door Right now I am having amnesia and deja vu at the same time. I think I've forgotten this before. When life gives you lemons, make apple juice, then laugh while people try to figure out what the heck you did. Duct tape is like the force, it has a light side and a dark side and it holds the universe together. Growing old is inevitable, Growing up is optional "God made man, and then he said, "I can do better than that," and made woman." - Adela Rodgers St. Johns It's the friends that you can call up at 4 AM that matter. Age is something that does not matter, unless you are a cheese. Somebody needs a Happy Meal. So, you are a cannibal. If Tylenol, Duct Tape, & a Band Aid can not fix it, you have a serious problem. Do not walk in my footsteps. I walk into walls.2. What should a woman wear to an interview at a hardware store?Woman? in a hardware store? what hath the world come to?3. Woman to woman...do you have a problem with....?My hubby and I share chores, just as we both get up and go to work in the mornings. I would not live with a man that could not do his part (unless health problems kept him from doing so). He's an adult, and if he lived alone, he would have to do them anyways, or hire someone. Maybe charge him a weekly fee for keeping house..... Or, better yet, cut him off, he will come around4. I need a list of Woman Temptresses/ Fatal Woman in movies!?Wow... Great question. Of the three main religions I shall give you examples to shore up what you ask.. Christianity..... has Samson and Delilah Muslims... Well the Burk-ha speaks for itself Jew.... He will not sleep in the same bed as his wife during menstruation, they also worship in a different part of the synagogue from the men... I look forward to reading the other answers. EDIT: of course i defer absolutely to Lawrence Louis .... excellent5. Does a woman make the clothes or do the clothes make the woman?neither... especially when she is in my bed and there are no clothes on her....WOOT!!6. What mens cologne drives a woman Wild "Woman ONLY"?I like the scent called. Ryan. Oh wait that's just my boyfriend's smell. Nothing can top that. But I guess it has to be axe. That's what he used for deodorant. I do not think he use's cologne. Good thing, guys cologne usually just makes me sneeze.7. Will the 2007 mininum wage increase in California affect me if I earn salary?The element that persons do no longer seem to understand is all of guy or woman well being is interrelated. occasion: vaccines are given out, yet whilst no longer everybody takes it somebody can fall ill and that person then provides the virus a huge gamble to mutate to something the vaccine did no longer look after you against, so which you are dealing with a plague. next if the emergency room is over worked with elementary circumstances then real emergencies run a intense threat of being misdiagnosed or forced to attend and lose serious time. we opt to forget approximately in regards to the dependency we've on one yet another, through fact we opt to think of we are all self sufficient, yet we are not. whilst replaced into the final time you plucked a poultry or killed a cow or made your guy or woman pasta or how approximately burn their trash these days?
Understand Round Table Discussion | an Introduction to Round Table Discussion
An Introduction to round table discussionThe Council of Hertford was the first general council of the Anglo-Saxon Church. It was convened in Anglo-Saxon Herutford, most likely modern Hertford, in 672 by Theodore of Tarsus, Archbishop of Canterbury. The Venerable Bede is the historical source for this council, as he included its text in his Ecclesiastical History of the English People.The council was attended by a number of bishops from across Anglo-Saxon England. Bede also records royal attendance, as King Ecgfrith of Northumbria was present. The Council of Hertford acted as a milestone in the organisation of the Anglo-Saxon Church, as the decrees passed by its delegates focused on issues of authority and structure within the church. The council helped achieve unification in the English Church.Creed of round table discussionThe chapters discussed are summarised as follows:Chapter 1That Easter Day is to be kept at the same time, namely on the Sunday after the fourteenth day of the moon of the first month. This was confirming the English adherence to the Roman calculation of Easter, as decided at the Synod of Whitby in 664.Chapter TwoThat no bishop intrude into the diocese of another bishop, and rather be content with their own diocesan rule.Chapter ThreeThat bishops are not to interfere in any way with monasteries, nor forcibly take any monastic property. Rumble has emphasised that this decree still allowed the local bishop to participate in the election of abbots in his diocese thereby not disregarding the right given by the Rule of St Benedict.Chapter FourThat monks are not to wander from place to place, meaning between monasteries. They may only do so if they have letters dimissory from their own abbot.Chapter FiveThat clergy are not to leave their own bishop nor wander about at will. Clergy are not to be received anywhere without letters commendatory from his own bishop. The receiver and the received risk excommunication if this is not obeyed. Godfrey has argued that chapters four and five, concerning wandering clerics and monks, were significant because they indicated the end of the migratory stage in the Conversion, and the establishment of a stable diocesan system.Chapter SixThat travelling bishops and clergy are to be content with the hospitality offered them, and not to exercise any priestly function without the bishop of the diocese's permission.Chapter SevenThat a synod is to occur twice yearly. However, this proposal prompted discussion and after hindrances emerged, it was thus decided that the bishops were to meet annually on 1 August at Clofesho. The location of Clofesho is unknown, and Cubitt has demonstrated that in practice this ruling was not followed.Chapter EightThat no bishop is to claim precedence over another bishop out of ambition, but that rank is according to order of consecration.Chapter NineThat more bishops shall be created as the number of the faithful increases. This measure was discussed but no decision was reached at this synod. This marked the introduction of Theodore's plan to create more dioceses, a policy which he continually advocated.Chapter TenConcerning marriage. Reasserting that nothing be allowed but lawful wedlock.Attendees of round table discussionBesides Theodore, Bede records four other bishops being present. These were: Bisi, bishop of the East Angles; Putta, bishop of Rochester; Leuthere, bishop of the West Saxons; and Winfrith, bishop of Mercia. Wilfrid of Northumbria was not present but was represented by proctors. As well as the bishops, many teachers of the church attended, and Titill the notary was present to document the decisions made. Despite there being few bishops in attendance, these bishops came from across Anglo-Saxon England, so the council was national in scope.In the chronological summary of his Ecclesiastical History, Bede records that King Ecgfrith was present at the council. This information is absent from Bede's main account of the synod in IV.5, and details of Ecgfrith's role at Hertford are unknown. Despite Ecgfrith's presence, Hertford was ecclesiastical in focus. Bede attests that it was Theodore who summoned the council and had authority over its proceedings. Bede describes Theodore as the first of the archbishops whom the whole English Church consented to obey. Theodore is depicted by Bede as an authority figure at Hertford, convening the synod and dictating to the notary Titill that which needed to be recorded.
Camelot on Film: 9 (Not-so) Brief, (Intermittently) Shining Moments
Guy Ritchie's King Arthur: Legend of the Sword, in theaters this weekend, is only the latest film to adapt the tales of King Arthur and his noble knights. There have been dozens, in several languages, beginning way back in 1904, with a silent film based on the Wagner opera Parsifal.It makes sense, right? The loose collection of legends in question represent an epic story filled with elements perennially ripe for big-screen treatment: the boy who discovers himself the rightful heir to the throne. The magic sword. The wise tutor. The battles that unite a kingdom. The noble knights, and their noble quests. And of course the love story, with its tragic ending.Filmmakers can approach such a sweeping tale from many different directions, playing up certain aspects, and dialing back others, to fit the story they want to tell. This narrative richness is one reason the legend of King Arthur keeps getting told and retold on the big screen.The other reason - equally important - is that the legend of King Arthur exists in the public domain.Below we'll take a look at some of the most notable cinematic interpretations of Camelot over the years.Before we do, though, let's stipulate that there are three essential elements to any film adaption of Arthurian legend - three boxes that must needs be checked, however obliquely, if the movie's gonna fulfill its promise.To wit:1. The Round TableI mean, duh. It's called visual iconography, look it up. Also the table represents something crucial about Arthur, the thing that makes him so enduringly appealing as a character, and as Britain's idealized monarch: he is flawed, yes, but he rules fairly. He sees himself not only as a uniter, but as a king among equals. The round table establishes his egalitarian bona fides. It's key.2. The Love TriangleFull disclosure: It bores me. I know, I know: it's called Arthurian Romance, after all. It's there to underscore Arthur's vulnerability, his flawed humanity, his emotional side. And in the right hands, it can serve to add layers of nuance to Guinevere, the story's only female presence of note who isn't an evil witch (Morgaine/Morgana/Nimue). I get why it's there. And I see why it's central. But it bores me.3. MerlinFull disclosure, part the second: Wheeeeee! Merlin! Magic and mystery! Pagan mysticism! Pointy hats! I love me some Merlin. He's there to connect Arthur to notions of eternity and fate and the unconscious, and without him, the legend of Arthur get diminished, its glamour fades, and it gets reduced to mere workmanlike alt-history. For me, the ideal Arthur-on-film fuel mixture is 20% Round Table, 5% Love Triangle, 75% Merlin. But I understand I am in the minority there. (Yes, I know: he's a late addition to the legend of Arthur. He was inserted by Geoffrey of Monmouth blah blah blah shut up. He's awesome. Merlin 4ever.)Let's take a look at nine notable onscreen Arthurs:Year: 2017Title: King Arthur: Legend of the SwordStory: Better than you think it's gonna be! Seriously! Charlie Hunnam's a jacked and genial Arthur, the dialogue is surprisingly nimble, and director Guy Ritchie keeps things moving at a brisk trot, bringing his distinctive visual style to the swords and sorcery genre. It's basically a heist film in shining armor. Lock, Stock and Two Smoking Baldrics.Several set-pieces involve Arthur learning to unlock the power of Excalibur, which feel like you're watching someone unleashing sick combos in Street Fighter.Sounds like a complaint. Isn't.Quibbles? Jude Law, as the eeeevil usurper-sorcerer Vortigern, doesn't go full-bore, Young-Pope-sinister, and you keep waiting for him to. Also, the CGI finale, which involves a a very silly-looking giant [redacted], is as big and loud and dumb as CGI finales tend to be.Running Time: And here's the other issue: 126 minutes. You chop half an hour off this thing, and you got yourself a tight little flick, perfect for watching from the couch on a lazy Sunday afternoon.Round Table? Yes, eventually.Love Triangle? No, weirdly. Hunnam didn't get a love interest in Pacific Rim, either. What gives?Merlin? Ssssssorta. Glimpsed at the beginning. But his traditional role is fulfilled by Àstrid Bergès-Frisbey, as a sort of gothy (lower-case g!) mage given to marble-mouthed mystical muttering.The Completely Subjective Once and Future Final Score: 7 out of 10.Year: 2004Title: King ArthurStory: As "the real story behind the legend" treatments go, fairly effective, thanks largely to a cast that features every working U.K. actor. All seven of them. Directed by Antione Fuqua, this version turns Arthur (Clive Owen) into a Roman cavalry officer, Guinevere (Keira Knightley) into a badass Briton warrior, and Merlin (Stephen Dillane) into a tribal chieftain.Given its focus on battle scenes, tribal alliances, and soldiers venturing beyond a wall (Hadrian's, in this case) the film feels less Arthurian than G.R.R.Martinian.Running Time: 126 minutes (Director's Cut: 142 minutes) (Yikes.)Round Table? Nope.Love Triangle? Barely. More hinted at than shown.Merlin? He's there in name only, as the film thumbs its nose at magic, opting for a grubbier, more realistic take that makes its seem awfully impressed with itself.The Completely Subjective Once and Future Final Score: Where's the magic, man? Where's the showmanship? Where's the zazz? 5 out 10 - but an extra point for doing something novel with Guinevere: 6 out of 10.Year: 1995Title: First KnightStory: Another interpretation that downplays the magic and ups the shmoopy, wet-eyed romance. Stars Sean Connery as an aging Arthur, Julia Ormond as a winsome Guinevere, and Richard Gere as an equally winsome, floppy-haired Lancelot.Running Time: 134 minutes.Round Table? Prominently featured.Love Triangle? Hoo boy, yes. There's so much of it, it's more like a love pyramid.Merlin? Completely absent! Which might explain why the film feels so plaintively dull.The Completely Subjective Once and Future Final Score: 4 out of 10. Wait, no, minus one point for the lousy pun in the title. 3 out of 10!Year: 1984Title: Sword of the ValiantStory: King Arthur meets I Love the 80s. Lantern-jawed beef-slab Miles O'Keefe IS! ... Gawain! Sean Connery IS! ... The Green Knight! And this movie IS! ... Cheesy!But it's a good cheese. An aged cheese. A cheese with bits of, like, savory herbs and whatnot inside it. Consider: Connery spends the entire running time with his face covered in green glitter. It's like he got pranked after passing out in a Michael's.Worth seeing, if only for Peter Cushing, John Rhys-Davies and Trevor Howard (as an old, cranky King Arthur) looking sheepish.Running Time: Only 102 minutes! Which is, when it comes to the Arthurian film canon, positively nimble.Round Table? It's more a series of banquet tables? Imagine a medieval bar mitzvah.Love Triangle? Nope.Merlin? Well there's no shortage of magic, certainly, but no Merlin to speak of.The Completely Subjective Once and Future Final Score: It's not, strictly speaking, Arthurian, even though Howard plays Arthur. It's more a spin-off - an Arthurian AfterM*A*S*H. So: 5 out of 10 for the cheesy goodness, minus one point for its off-brand content.Year: 1981Title: ExcaliburStory: Oh, man. This is the stuff, right here. Arthurian legend as gleefully indulgent prog-rock concept album. John Boorman's direction is ... you know, not subtle: this is visceral, passionate and, given how often Orff and Wagner turn up on the soundtrack, literally operatic.Running Time: 140 minutes.Round Table? You bet, and it never looked better. Polished to perfection. The knights sitting around it look like shiny, tinfoil-encased birth-control pills convinced of their own nobility.Love Triangle? Geez, yes. Guinevere and Lancelot sport pretty much identical perms, so maybe that's the source of their passion.Merlin? No, not just Merlin. The most Merlin. Nicol Williamson is on fire here, sending his sinuous voice through an endless series of corkscrew turns and barrel-rolls. The film wisely picks up on a frequent theme of Arthurian legend - the fading of Magic and the rise of Man - and lets Merlin personify it, with the full force of Williamson's mercurial gifts. He leaves after the first act, and the film sags, but Helen Mirren as the devious Morgana picks up the slack. (This writer may or may not, as a kid, have worn his VHS copy thin rewinding the Merlin/Morgana seduction scene, so he could memorize The Charm of Making.)The Completely Subjective Once and Future Final Score: 10 out of 10. Yes, it's a little long, but that's unavoidable - just par for the Arthurian course.Year: 1975Title: Monty Python and the Holy Grail Story: An extended, disjointed, sketch-based riff on Arthurian legend. Every nerd of your acquaintance has at least five minutes of it committed to memory. It's how they recognize each other in the wild.Running Time: 92 minutes. Only one of many things this film gets right.Round Table? Nope. Camelot is glimpsed, but only in a throwaway gag.Love Triangle? Shyeah. Right. See above, in re: nerds.Merlin? Swapped out for Tim the Enchanter.The Completely Subjective Once and Future Final Score: 9 out of 10. Would have gotten a 10, but man, that ending still rankles, every time you see it.Year: 1967Title: CamelotStory: The Lerner and Lowe musical came to the big screen seven years after debuting on Broadway. The tunes are catchy, the cinematography's sumptuous, the film is leaden. Richard Harris talk-sings with the best of them, and if you ever need a pick-me-up, Google Vanessa Redgrave's take on "The Lusty Month of May" - homegirl positively chews those lyrics like they're salt water taffy. But it just keeps going on and on and on.Running Time: 179 minutes! The humanity!Round Table? Yup.Love Triangle? Very much so. Too damn much so.Merlin? Yes, but not enough. Not nearly enough. Just makes you miss him all the more.The Completely Subjective Once and Future Final Score: 7 out 10. Minus one point for not knowing when to quit: 6 out of 10.Year: 1963Title: The Sword in the StoneStory: Disney's animated adaptations of T.H. White's whimsical Arthurian bildungsroman is a charming, if slight, addition to the canon. Karl Swenson voices Merlin, and he absolutely nails it.Running Time: 79 minutes.Round Table? Nope, this comes before any of that.Love Triangle? Again, it's a prequel. There is some business with an amorous lady squirrel, but ... but that's probably not what you mean.Merlin? Yes, and he's in fine form, and there's lots and lots of him. Plenty of transformations and spell-casting - it's all any of us who always pick the Mage Guild in Skyrim want from a movie, really.The Completely Subjective Once and Future Final Score: 8 out of 10.Year: 1949Title: A Connecticut Yankee in King Arthur's CourtStory: A feather-light adaptation of Mark Twain's novel, starring Bing Crosby as a mechanic transported back to the court of King Arthur. Doesn't really tick off any of the classic Arthurian boxes, not that it's interested in doing so. But as an example of mid-career Der Bingle, perfectly passable.Running Time: 106 minutesRound Table? Not so much - this is another example of a golden-year King Arthur story.Love Triangle? None to speak of.Merlin? He's here, but he's not so much magical as evil - a charlatan scheming to usurp the throne. In a bad wig.The Completely Subjective Once and Future Final Score: 6 out of 10. Minus two points for that wig. 4 out of 10.
Knowledge About Round Table Discussion,Bharatiya Jana Sangh of Round Table Discussion
1.BharatiyaJanaSanghofroundtablediscussionTowardstheendof1950,ShyamaPrasadMookerjeegatheredinDelhiacoregroupofactivistsincludingM.C.Sharmaforforminganewpoliticalparty,thefutureBharatiyaJanaSangh.SeveralothermembersofthecoregroupwereRSSpracharaks.SharmaplayedanactivepartinformingthePunjab-DelhibranchofJanaSanghon27May1951,whichlaterbecamepartofthenationwideBharatiya'JanaSangh.HewasnamedasaGeneralSecretaryofthenation-wideparty,withtheRSSpracharakBhaiMahavirbeingtheotherGeneralSecretary.ThisindicatedanequitablesharingofinfluenceintheJanaSanghbytheHindutraditionalistpoliticiansandtheHindunationalistRSS.JanaSanghhadbeenformedontheeveofthefirstGeneralElectionsof1951-52.Thepartywononly3seatsintheLokSabha,includingthatofMookerjee.SharmacontestedfortheLokSabhaseatfromOuterDelhi,butlost.Hesecured74,077votesor16percentofthevotescast.WhenMookerjeediedinJune1953,SharmawasappointedastheActingPresidentoftheJanaSangh.Bythistime,DeendayalUpadhyaya,anotherRSSpracharakfromUttarPradeshwastheGeneralSecretaryoftheparty,andhadfirmcontrolofitsRSSfaction,enjoyingthefullconfidenceoftheRSSchiefM.S.Golwalkar.Sharmafoundhispositionweakevenwithintheparty'scentraloffice.TherewerediscussionstomergeJanaSanghwiththeHinduMahasabhaandRamRajyaParishadtoformasinglepartyrepresentingtheHinduinterests.AstatementofSharmacallingtheHinduMahasabhaa'communalbody'issaidtohavebrokenoffthenegotiations.However,accordingtoN.C.Chatterjee,thePresidentoftheHinduMahasabha,V.D.SavarkarblockedthemergerproposalsbecausehedislikedGolwalkarandexpectedthatthecombinedorganisationwouldbedominatedbytheRSS.BalrajMadhok,amemberoftheRSSfactionintheWorkingCommittee,warnedintheRSSmagazineOrganiserthatwhoeverbecamethenextPresidentofJanaSanghwouldneedtosecurethe"willingcooperation"oftheRSSswayamsevaksintheParty.BeingtheActingPresident,SharmawasanaturalcandidateforthePresidency.However,attheparty'ssecondplenarysessioninBombayin1953,SharmawastolduponhisarrivalthattheRSSheadquartersatNagpurhaddecidedinfavourofanotherpersonandhewasaskedtostanddown.Somepartyleadersthreatenedtotakethemattertotheopenmeeting,forcingtheRSSfactiontorelent.SharmawasthengivenafullslateoftheWorkingCommitteemembersthathewasaskedtoappoint,whichalsobecameamatterofcontention.Despitehisresistance,theeventualcompositionoftheWorkingCommitteewasheavilyweightedinfavouroftheRSSfaction,includingsuchRSSleadersasBhaiMahavir,JagannathraoJoshi,NanaDeshkukh,AtalBihariVajpayee,BalrajMadhok,BhaironSinghShekhawatandSunderSinghBhandari.VasanthraoOke,whowasalsoanRSSpracharak,wasnotintheoriginallistbecausehewasseenbytheRSSleadershiptohavebecometooclosetothepoliticians.HewasincludeduponSharma'sinsistence.SharmaandOkemadeeffortstorecruitpartyworkersandalsotoraisefundsfrombusinesstofinancetheexpansionoftheParty.TheseeffortswerethwartedbytheRSSfactionbecausetheysawitasanefforttoreducetheparty'sdependenceontheRSS.AttheIndoresessionoftheCentralGeneralCouncilinAugust,Sharma'sPresidentialaddressemphasisedtheprincipleslaiddowninthePartyconstitution,namely,"secularnationalismandunflinchingfaithindemocracy."However,afusswasraisedthathewastoouncriticaloftheGovernment.AdelegatefromPunjabbroughtforwardaresolutioncondemningtheinterferenceoftheRSSinpartyaffairs,anditwasdecidedtoreferittoafurthersessionoftheCouncil.However,UpadhyayaastheGeneralSecretaryrefusedtoacallasecondmeetingoftheCouncilandmaintainedthatthedecisionbelongedtotheWorkingCommittee,notthePresident.Inresponse,Sharmaresigned.AccordingtoAndersenandDamle,heanticipatethepurgeofthenon-RSSpartyworkersandtriedtoavertit.InastatementtoTheStatesman,SharmastatedthatdifferencesofopinionregardinginterferencebytheRSShadbeenpersistentforoverayear.HeconfidedthatShyamaPrasadMookerjeewas"seriouslyperturbed"bythedemandsoftheRSSleadersintheappointmentofoffice-bearers,nominationofcandidatesandmattersofpolicy."AvigorousandcalculateddrivewaslaunchedtoturntheJanaSanghintoaconvenienthandleoftheRSS.OrderswereissuedfromtheirheadquartersthroughtheiremissariesandtheJanaSanghwasexpectedtocarrythemout.ManyworkersandgroupsalloverthecountryresentedthisandtheDelhiStateJanaSanghasabodyrefusedtocomply."SharmahopedthathisresignationandrevelationsaboutinterferencebytheRSSwouldrallythepartymembers.HealsoexpectedameetingoftheGeneralCounciltobecalledasitalonehadtheconstitutionalpowertoaccepthisresignation.However,theWorkingCommitteeacceptedhisresignationonitsownandappointedBapuSahebSohni,theRSSsanghchalakfromBerar,astheActingPresident.TheWorkingCommitteecondemnedwhatitdescribedasSharma'sattempt"toabusetheJanaSanghforumtotrytorundowntheRSS."ItcalledhisactionsundemocraticandunfairtothemembersoftheWorkingCommittee.SharmawasexpelledfromthepartyandtheDelhiunitthatbackedhimwassummarilydissolved.OrganiserinformeditsreadersthatSharmasufferedfrom"insufferableself-aggrandisement"andhewashardlythemantoleadthegreatandgrowingorganisationoftheJanaSangh.Subsequently,SharmarejoinedtheCongressParty.TheDelhiunitofficialsformedanewpartycalledtheNationalDemocraticFront,whichlastedtill1957.Ina1974interview,SharmaclarifiedthatheandhissupporterswereinsympathyofthebasicaimsoftheRSSandthathegreatlyadmiredtheworkoftheRSSinitseffortstostrengthentheHinducommunity.ThemainconcernswereabouttheRSSdominationoftheJanaSangh.He,likeMookerjee,wantedJanaSanghtoremainopentootherinfluencesandtousethemforfurthergrowth.TheyoungRSSorganisers,ontheotherhand,wereintentuponmakingtheJanaSanghmorecentralisedandmoredisciplined,verymuchintheimageoftheRSSitself.
Understand Round Table Discussion | an Introduction to Round Table Discussion
An Introduction to round table discussionThe Council of Hertford was the first general council of the Anglo-Saxon Church. It was convened in Anglo-Saxon Herutford, most likely modern Hertford, in 672 by Theodore of Tarsus, Archbishop of Canterbury. The Venerable Bede is the historical source for this council, as he included its text in his Ecclesiastical History of the English People.The council was attended by a number of bishops from across Anglo-Saxon England. Bede also records royal attendance, as King Ecgfrith of Northumbria was present. The Council of Hertford acted as a milestone in the organisation of the Anglo-Saxon Church, as the decrees passed by its delegates focused on issues of authority and structure within the church. The council helped achieve unification in the English Church.Creed of round table discussionThe chapters discussed are summarised as follows:Chapter 1That Easter Day is to be kept at the same time, namely on the Sunday after the fourteenth day of the moon of the first month. This was confirming the English adherence to the Roman calculation of Easter, as decided at the Synod of Whitby in 664.Chapter TwoThat no bishop intrude into the diocese of another bishop, and rather be content with their own diocesan rule.Chapter ThreeThat bishops are not to interfere in any way with monasteries, nor forcibly take any monastic property. Rumble has emphasised that this decree still allowed the local bishop to participate in the election of abbots in his diocese thereby not disregarding the right given by the Rule of St Benedict.Chapter FourThat monks are not to wander from place to place, meaning between monasteries. They may only do so if they have letters dimissory from their own abbot.Chapter FiveThat clergy are not to leave their own bishop nor wander about at will. Clergy are not to be received anywhere without letters commendatory from his own bishop. The receiver and the received risk excommunication if this is not obeyed. Godfrey has argued that chapters four and five, concerning wandering clerics and monks, were significant because they indicated the end of the migratory stage in the Conversion, and the establishment of a stable diocesan system.Chapter SixThat travelling bishops and clergy are to be content with the hospitality offered them, and not to exercise any priestly function without the bishop of the diocese's permission.Chapter SevenThat a synod is to occur twice yearly. However, this proposal prompted discussion and after hindrances emerged, it was thus decided that the bishops were to meet annually on 1 August at Clofesho. The location of Clofesho is unknown, and Cubitt has demonstrated that in practice this ruling was not followed.Chapter EightThat no bishop is to claim precedence over another bishop out of ambition, but that rank is according to order of consecration.Chapter NineThat more bishops shall be created as the number of the faithful increases. This measure was discussed but no decision was reached at this synod. This marked the introduction of Theodore's plan to create more dioceses, a policy which he continually advocated.Chapter TenConcerning marriage. Reasserting that nothing be allowed but lawful wedlock.Attendees of round table discussionBesides Theodore, Bede records four other bishops being present. These were: Bisi, bishop of the East Angles; Putta, bishop of Rochester; Leuthere, bishop of the West Saxons; and Winfrith, bishop of Mercia. Wilfrid of Northumbria was not present but was represented by proctors. As well as the bishops, many teachers of the church attended, and Titill the notary was present to document the decisions made. Despite there being few bishops in attendance, these bishops came from across Anglo-Saxon England, so the council was national in scope.In the chronological summary of his Ecclesiastical History, Bede records that King Ecgfrith was present at the council. This information is absent from Bede's main account of the synod in IV.5, and details of Ecgfrith's role at Hertford are unknown. Despite Ecgfrith's presence, Hertford was ecclesiastical in focus. Bede attests that it was Theodore who summoned the council and had authority over its proceedings. Bede describes Theodore as the first of the archbishops whom the whole English Church consented to obey. Theodore is depicted by Bede as an authority figure at Hertford, convening the synod and dictating to the notary Titill that which needed to be recorded.
10,000 Buddhas: a Labour of Love Is Complete at a Calgary Monastery
A two-year labour of love, devotion and faith is ending in triumph for a Calgary Buddhist Monastery.Tirelessly organized by Heng Syun, a female monk at the downtown place of worship, the journey to hand-produce 10,000 exquisite Buddha statues came to fruition this last weekend.In completing the task, the monastery's 11 femalemonks along with countless volunteers are also on track to raise $2-million towards the $5-million needed for a new roof and additional floor for the building at 1009 - 4 Ave. S.W.The remarkable feat has become a worldwide effort as supporters across the globe sponsored and dedicated the Buddha statues, which come in three sizes and are laboriously produced on site and by hand.Once the new floor of the Avatamsaka Monastery is officially opened - likely in the summer of next year - the 10,000 Buddhas will line the walls of the planned new hall of worship."We have had 27 countries taking part. It is a very meaningful project," said Heng Syun.Those dedicating a Buddha could choose to get involved in making it themselves or leave it in the hands of capable volunteers. The believer's name, or the name of the person he or she is dedicating the statue to, is inscribed on the base at completion. Donations range from $150 for the 18-centimetre high image to $500 for the largest, 36-centimetre size.A cardboard base - covered in text chosen by the person making the donation from more than 300 Buddhist scrolls - is then first placed into a mould where gypsum is added to form the initial statue. The inside is hollow to both cut down on weight and to allow a sacred text scroll to be inserted and hung from two pins.Once that process is complete the statue is then scraped of any rough edges, left to dry and then sanded before the base is levelled and the statue varnished and polished."It is representing peace, but in this project it involves so many steps it is actually Buddhist art," said Heng Syun. "If we were to mass-produce them in China or Vietnam, then 10,000 could have been done very quickly, but here we produced every one by our own hands."As co-ordinator of the project, Heng Syun said the idea of fundraising through the project wasn't her initial thought but the idea built upon itself, step by step."It came bit by bit. It wasn't as though I had this big idea. I thought 'why don't we create it ourselves, instead of a factory,'" she recalled.Those who have sponsored a statue have not all been of the Buddhist faith. Anyone was invited to become a part of the project as long as they were fine with writing the sacred text, which forms the core of the initial construction."You must invest your heart in the piece," added Heng Syun.Although the 10,000 statues have been completed, the monastery volunteers are still at work making an extra few hundred to fill in any gaps when the Buddhas are brought together to line the prayer hall walls. So far, about 7,500 have been sponsored and it is hoped all will be claimed by the time the monastery's new floor is opened.The Avatamsaka Monastery is a branch of the Dharma Realm Buddhist Association in Alberta, which first arrived in the city in 1985 and opened a place of worship in the Ramsey area.The current location on the edge of downtown, in which the femalemonks are housed in dormitories on the top floor, was opened 20 years ago.Over that time, Heng Syun has seen more people of other faiths become interested in Buddhism."It is a way of life -a philosophy. I would say Buddhism to the majority of people in the West starts with meditation. They can sense that spiritual feeling when they do that," she said.Every Wednesday night between 7 p.m. and 9 p.m.,the monastery is open to people of all faiths to take part in meditation followed by round table discussions."Many people join us," she said. "They are not necessarily Buddhist; they are Hindus and Muslims and Christians. It is a good space to share with people."
Judge the NPA by What It Does in Court Advocate
Pretoria - Advocate Malini Govender from the Specialised Commercial Crimes Unit is adamant that the National Prosecuting Authority (NPA) is working optimally. "If South Africa wants to judge the National Prosecuting Authority, judge us by what we are doing in court," Govender said.AS IT HAPPENED: Hawks investigating #StateCaptureSpeaking at a media round table discussion on anti-corruption at the Government Communication and Information System (GCIS) offices in Pretoria on Friday morning, Govender said her unit met 88% of their target, the best since 1998.The panel faced some tough questions from the media during the session. Govender said it was incorrect to say there were no cases opened in terms of state capture. While Hawks Brigadier Zama Basie said they were investigating state capture, Basie said Treasury formed a critical part of the investigations.When asked about the NPA allowing President Jacob Zuma to make representations in his corruption case, Govender said they will always consider representations from any accused in any case, and not just the president. Govender said her unit was focused on working on complex organised corruption cases.She was part of a panel of speakers which included Advocate Knorx Molelle from the Asset Forfeiture Unit (AFU), Advocate Gerhard Visagie from the Special Investigating Unit (SIU) and Roderick Davids from the sub-committee: National Anti-Corruption Strategy.The anit-corruption panel at the GCIS in Pretoria. @TeamNews24 pic.twitter.com/vlqQWhyTjL- Iavan Pijoos (@iavanpijoos) November 10, 2017 The round table discussion, which lasted over two hours in total, revealed that the unit had finalised nine serious private sector corruption cases and five public sector corruption matters over the last year.No unificationConvictions were obtained against 311 government officials from April 2016 to date.Govender said the corruption case against former Northern Cape chairperson John Block had stood out for her.-Read: Former Northern Cape ANC chair John Block gets 15 years in jail Block and businessman Christo Scholtz were sentenced to an effective 15 years in jail for money laundering and corruption.Meanwhile, Davids said South Africa had never had a unified approach to fighting corruption.#SAFightingCorruption: According to Davids SA has never had a unified approach to fighting corruption. @TeamNews24- Iavan Pijoos (@iavanpijoos) November 10, 2017 He said government was working on a national strategy and that their diagnostic report had found that financial management, supply chain management and leadership were the main issues relating to corruption.Davids said they would have an in-depth consultative process with stakeholders to map out the best strategy.
How to Make a Square Table Cloth Fit Onto a Round Table?
That does not seem like it would be a hard size to find, but I guess it just depends on where you are:) You could always make one out of a pretty, pastel colored flat sheet! It would be super simple, just measure, cut it and hem it & iron it. (Wash & dry it before you start:) Then you could put a lace runner over it. The lace could even be a different shape, and look really good! Or use some pretty placemats. I am sure if you did not need one so soon, you could find one on eBay though. Or, JCPenney:) Happy Easter!!1. wwe 07 table ?help?try setting up the first table then go and get another table keep hold on the one in your hands and go to the table that is already set up and press "x" they should stack on each other then2. Override table in sphinxThe L column type is useless as far as tabu is concerned.Note that we have to swallow the first hline otherwise and place it by hand, because it's illegal after owcolor3. Printing a multiplication tableHonestly your code doenst look that bad. I think the way he wanted it is something like (Off Top of my head, not tested or anything)Which would essentially do the same thing but in 5-6 lines of code4. table in table-environment - text is badly formatedUsing booktabs you can achieve the following:5. Clickable Table FootnoteYou can use the tablefootnote package (loaded after hyperref) and in the table tablefootnote instead of footnote. There is no optional parameter to the command, but you do want automatic numbering if I understand your question right6. Table Management for DummiesIf you want to convince your boss to start using LaTeX, you can show him/her Excel-to-LaTeX or an online version to exports the current selection of tables in Excel to LaTeX. I do not think migrating from Microsoft Word to Microsoft Excel would cause any trouble for someone who has used Microsoft for a long time7. Is there a way to automate a priority table in Google Sheets based on another table?While this is not exactly the goal format you mentioned, i actually think it might be easier to keep track. Here is a sample sheet.This formula you will find once for each class. it will build the whole class in order of student priority with their priority numbers to the left of the name.8. Table of tournament scoresCondider drawing borders at least around the header cells, to make the header structure easier to see. Wrap the two header cell rows in a thead element; this helps e.g. when the page is printed (the thead rows are repeated at the start of a new page in many moder browsers), and otherwise. Accessibility would be improved by adding extra markup that associates data cells with header cells, but it's difficult to say what would be the best approach here9. Wrap text in table column header AND fit table width to pagewidthI would use siunitx and tabular* instead of tabularx, because you are so able to get perfect output for the numbers. The first example is how you can do with tabularx, but note that you would have to manually correct the input for numbers. With the siunitx approach you can just input numbers as they are.10. Pivot table formattingYou might be able to use conditional formatting instead of formatting individual cells. I have a pivot table that tracks if deadlines are missed:Select a cell you want to format, go to conditional formatting, and click on "New Rule". Then, you can select which cells you want to format (in my case, the second option), chose your criteria (for me it was if the date is greater than the column next to it on the left), and set your formatting. My formatting remains regardless of what I add to the table. If you add different columns or cells you want to apply rules to, you will need to create new formatting rules for those. But, if your columns are fairly consistant, this might do the trick.11. syntax table malfunctionYour approach almost works, but you can not only modify the syntax for the opening if you want that to match the closing , so you need both of:For the second part of your question, see:
Bunkie Board Instead of Bed Slats with an Ikea MALM Platform Bed?
Are you making your own?, my son-in-law did that, the same as it sounds like you want, it worked out Great. Good Luck.1. How can i make a nice platform bed for cheap?Get up early on Saturday morning and go to garage sales. Every thing you need is there and cheap, a bed your looking for $20 maybe a little more, I have found some really nice things. As time goes buy and you can afford what you want, recycle and have your own sale!2. What kind of wood is the best and most inexpensive to use for building a platform bed for a california king?Pine or Douglass Fir3. I am working on a platform bed? Where can I buy oversize plywood? At least 60"X80"?if you have a good lumber yard nearby, you can special order there,99 ....they are called 'blows' if all else fails for you, purchase, 2 sheets of 1 1/8" T & G 4'x8' and glue & clamp them together and saw to desired dimensions.4. Does anyone here have a platform bed?My best friend has one and they hurt their shins. I also looked at a few at rooms to go and I banged my shin5. How To Build A Twin Platform BedWe have a guest that will be staying the night, a very messy guest room, and a twin mattress ... on the floor. I decided to get busy and Build A Twin Platform Bed with the thought that one of our kids could use it when they are off at college, renting a room off campus. Eventually, I would like to have a queen size bed in the guest room but this makes sense for now! This twin platform bed was pretty simple and inexpensive to build. It needed to be easy to disassemble so it could be hauled around easily and it needed to be inexpensive because ... this is not meant to be a family heirloom. Nope! It has a purpose to serve on a budget! This post contains affiliate links. When you purchase through an affiliate link, we receive a small commission at no additional cost to you. Disclosure. Our twin size mattress dimensions are 37-1/2 x 73-1/2 x 11 and I built this bed to fit those dimensions. Adjust your cuts to accommodate your mattress size. Note: My cuts are 2-1/2 shorter than our mattress size. This is because the mattress partially sits on top of the 4 x 4 legs. if you choose not to use casters, adjust the cut of the legs. Our twin mattress has a hard bottom and needed less slats than our Naturepedic mattress did. How To Assemble The Twin Platform Bed This bed is actually pretty simple to build! Make your cuts, according to your mattress size, and sand each piece with 120 grit sand paper. With the Kreg Jig, drill three pocket holes in each end of your headboard and footboard panel. Pay attention to what side of the board you want to be visible and make the pocket holes on the opposite side. Next, attach the headboard and footboard panels to the legs with 2-1/2 pocket hole screws. I placed a 1 x 4 under each end of the panel so the panel would sit back a bit from the 4 x 4 leg instead of being flush. The top of the panel and the top of the legs are flush. The next picture will show what I mean! The headboard and footboard assembled. Pretty basic, right? Then, attach the bed rail hooks on each 4 x 4 leg. I attached mine 2-1/2 from the top and as close to the inside edge that I could, in order to leave room for the side rail. Oh my goodness! These are non-mortise bed rail hooks! I struggled with the mortise bed rail hooks I used on our King Size Farmhouse Bed so I was pretty stoked to find these bed rail hooks! Now it was time to attach the bed slat supports. To do this, I laid the 2 x 4 on the inside of the 2 x 10 side rail and placed my 2 x 2 on top so I would know where to attach the 2 x 4. We want the mattress to sit right on top of this platform bed. I used Kreg Clamps and 2-1/2 Deck Plus Screws to attach the bed slat supports. This part was a bit tricky. The bed rail hooks needed to be lined up just right so the bed rail would sit flush with the headboard and footboard. I laid the footboard and headboard on the ground with the hooks attached. Then, I had my husband hold the side rails up against it, where I wanted it to be, and marked the screw holes. I am glad I did it this way because the hooks sit back a bit on the bed rail in order to sit flush. I would not have known that if I had only measured the correct height. The bed rails were pretty easy to attach and it was all flush ... enough! I used Homemade Stain for my Twin Bed. After the bed was stained, I took it apart, laid the pieces on sawhorses, and finished each piece with a coat of wax. I then attached a caster wheel to each leg. After the wax was dry, I took the bed pieces into the guest room and reassembled it. This is where you would measure the inside dimension of your bed so you can cut your bed slats the proper width. I placed the bed slats and side rail blocks where they needed to go. Next, I attached each block to the side rail support by pre-drilling a hole and then used one self-sinking screw in each block. This was a bit tedious as I used my Kreg Clamp on each block to keep it from moving. We are happy with this simple Twin Platform Bed! It was easy and inexpensive to build and should be a good thing to have around when the kids say goodbye to dorm life and rent a room, when they are off at college. Of course, we are also quite happy that our guest will not have to sleep on a mattress, on the floor. How To Make Wood Stain With Common Household Products Fun DIY House Projects You Can Do Too!
no data

KingBird Home Furniture